PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015888238.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family NAC
Protein Properties Length: 287aa    MW: 31826.8 Da    PI: 9.7802
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015888238.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.37.1e-54151421128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeelvv+yLkkk+++ +l++ ++i+e+d+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk++l++
  XP_015888238.1  15 LPPGFRFHPTDEELVVHYLKKKAASAPLPV-TIIAEIDLYKFDPWELPSKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPILTS 108
                     79****************************.89***************8888999*************************************998 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++++vg+kk Lvfy g+ pkg kt+W+mheyrl
  XP_015888238.1 109 nGNHKVGVKKALVFYGGKPPKGIKTNWIMHEYRL 142
                     67788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-648180IPR003441NAC domain
PROSITE profilePS5100561.76315179IPR003441NAC domain
PfamPF023652.7E-2816142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MESTDSSTGS QHPQLPPGFR FHPTDEELVV HYLKKKAASA PLPVTIIAEI DLYKFDPWEL  60
PSKATFGEQE WYFFSPRDRK YPNGARPNRA ATSGYWKATG TDKPILTSNG NHKVGVKKAL  120
VFYGGKPPKG IKTNWIMHEY RLADGKNSSA TTTKPPDSTP NKKASLRLDD WVLCRIYKKN  180
NSQRPIIDRD KDDAMEAMLM PSMQGQLSVA SSQQNPKPPL SKPANYASLL ENDDSFFEGI  240
LSGDGMQNTS SISHHQFATS SSKSNLAAAV KRPPPQQFWN DVGSIGN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D1e-741518220171NAC domain-containing protein 19
3swp_C1e-741518220171NAC domain-containing protein 19
3swp_B1e-741518220171NAC domain-containing protein 19
3swp_A1e-741518220171NAC domain-containing protein 19
3swm_D1e-741518220171NAC domain-containing protein 19
3swm_C1e-741518220171NAC domain-containing protein 19
3swm_B1e-741518220171NAC domain-containing protein 19
3swm_A1e-741518220171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00058PBMTransfer from AT1G61110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015888238.10.0PREDICTED: NAC transcription factor 25-like, partial
SwissprotQ8GY421e-114NAC25_ARATH; NAC transcription factor 25
TrEMBLA0A061GMK31e-142A0A061GMK3_THECC; NAC domain containing protein 25
STRINGPOPTR_0004s03820.11e-139(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.11e-115NAC domain containing protein 25